IgA (Middle Region) Antikörper

Details zu Produkt Nr. ABIN635180
Antigen
Epitop
Middle Region
1
1
Reaktivität
Human
2
1
Wirt
Kaninchen
3
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
3
2
1
1
Optionen
Immunogen PIGA antibody was raised using the middle region of PIGA corresponding to a region with amino acids SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR
Spezifität PIGA antibody was raised against the middle region of PIGA
Reinigung Affinity purified
Antigen
Hintergrund PIGA is a protein required for synthesis of N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI), the first intermediate in the biosynthetic pathway of GPI anchor. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. Paroxysmal nocturnal hemoglobinuria, an acquired hematologic disorder, has been shown to result from mutations in this gene.
Molekulargewicht 19 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

PIGA Blocking Peptide, catalog no. 33R-8916, is also available for use as a blocking control in assays to test for specificity of this PIGA antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGA antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-IgA (Middle Region) antibody (ABIN635180) PIGA antibody used at 1 ug/ml to detect target protein.