IgA Antikörper (Middle Region)

Produktnummer ABIN635180

Produktdetails anti-IgA Antikörper

Target: IgA

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IgA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PIGA antibody was raised against the middle region of PIGA

Aufreinigung: Affinity purified

Immunogen: PIGA antibody was raised using the middle region of PIGA corresponding to a region with amino acids SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIGA Blocking Peptide, catalog no. 33R-8916, is also available for use as a blocking control in assays to test for specificity of this PIGA antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGA antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IgA

Target: IgA

Abstract: IgA Produkte

Synonyme: MB-1 antikoerper, IG-alpha antikoerper, IGA antikoerper, IgA antikoerper, Igh-2 antikoerper, CD79a molecule antikoerper, immunoglobulin heavy constant alpha antikoerper, CD79A antikoerper, Igha antikoerper

Substanzklasse: Antibody

Hintergrund: PIGA is a protein required for synthesis of N-acetylglucosaminyl phosphatidylinositol (GlcNAc-PI), the first intermediate in the biosynthetic pathway of GPI anchor. The GPI anchor is a glycolipid found on many blood cells and which serves to anchor proteins to the cell surface. Paroxysmal nocturnal hemoglobinuria, an acquired hematologic disorder, has been shown to result from mutations in this gene.

Molekulargewicht: 19 kDa (MW of target protein)