SLC3A1 Antikörper (Solute Carrier Family 3 (Cystine, Dibasic and Neutral Amino Acid Transporters, Activator of Cystine, Dibasic and Neutral Amino Acid Transport), Member 1) (N-Term)

Details for Product anti-SLC3A1 Antibody No. ABIN635179
Antigen
Epitop
N-Term
8
6
4
3
2
1
1
1
1
Reaktivität
Human
52
15
13
2
2
2
2
2
2
2
1
1
Wirt
Kaninchen
42
10
Klonalität
Polyklonal
Konjugat
Dieser SLC3A1 Antikörper ist unkonjugiert
3
2
2
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
44
25
12
9
3
3
1
1
1
1
Optionen
Immunogen SLC3 A1 antibody was raised using the N terminal of SLC3 1 corresponding to a region with amino acids DFREVDPIFGTMEDFENLVAAIHDKGLKLIIDFIPNHTSDKHIWFQLSRT
Spezifität SLC3 A1 antibody was raised against the N terminal of SLC3 1
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC3A1 (SLC3A1 Antibody Abstract)
Hintergrund This gene encodes a type II membrane glycoprotein which is one of the components of the renal amino acid transporter which transports neutral and basic amino acids in the renal tubule and intestinal tract.
Molekulargewicht 79 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC3A1 Blocking Peptide, catalog no. 33R-1937, is also available for use as a blocking control in assays to test for specificity of this SLC3A1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 3 (Cystine, Dibasic and Neutral Amino Acid Transporters, Activator of Cystine, Dibasic and Neutral Amino Acid Transport), Member 1 (SLC3A1) (N-Term) antibody (ABIN635179) SLC3A1 antibody used at 1 ug/ml to detect target protein.