DLG3 Antikörper

Produktnummer ABIN635177

Der Kaninchen Polyklonal Anti-DLG3-Antikörper wurde für WB validiert. Er ist geeignet, DLG3 in Proben von Human, Ratte und Maus zu detektieren.

Kurzübersicht für DLG3 Antikörper (ABIN635177)

Target: DLG3 (Discs, Large Homolog 3 (DLG3))

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DLG3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DLG3 Antikörper

Aufreinigung: Affinity purified

Immunogen: DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DLG3 Blocking Peptide, (ABIN939108), is also available for use as a blocking control in assays to test for specificity of this DLG3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DLG3

Target: DLG3 (Discs, Large Homolog 3 (DLG3))

Andere Bezeichnung: DLG3

Hintergrund: DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).

Molekulargewicht: 58 kDa (MW of target protein)