MUC1 Antikörper (Mucin 1, Cell Surface Associated) (Middle Region)

Details for Product anti-MUC1 Antibody No. ABIN635176
Antigen
Epitop
Middle Region
44
39
18
15
15
14
8
8
7
7
7
6
6
6
6
5
5
5
4
4
4
4
3
3
3
3
3
3
3
3
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Reaktivität
Human
1108
165
71
16
7
6
5
4
4
3
3
2
1
Wirt
Kaninchen
722
407
4
3
Klonalität
Polyklonal
Konjugat
Dieser MUC1 Antikörper ist unkonjugiert
60
42
29
29
25
24
11
11
11
11
11
11
11
11
11
11
11
11
11
10
10
10
10
10
10
3
3
3
3
3
2
2
Applikation
Western Blotting (WB)
535
449
424
363
313
282
122
115
54
47
44
40
39
33
23
14
10
9
6
5
4
3
2
2
Optionen
Immunogen MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids ASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEM
Spezifität MUC1 antibody was raised against the middle region of MUC1
Reinigung Affinity purified
Antigen
Andere Bezeichnung MUC1 (MUC1 Antibody Abstract)
Hintergrund MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.
Molekulargewicht 14 kDa (MW of target protein)
Pathways Negative Regulation of intrinsic apoptotic Signaling
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

MUC1 Blocking Peptide, catalog no. 33R-1532, is also available for use as a blocking control in assays to test for specificity of this MUC1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Mucin 1, Cell Surface Associated (MUC1) (Middle Region) antibody (ABIN635176) MUC1 antibody used at 1 ug/ml to detect target protein.