MUC1 Antikörper (Middle Region)

Produktnummer ABIN635176

Produktdetails anti-MUC1 Antikörper

Target: MUC1 (Mucin 1 (MUC1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MUC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MUC1 antibody was raised against the middle region of MUC1

Aufreinigung: Affinity purified

Immunogen: MUC1 antibody was raised using the middle region of MUC1 corresponding to a region with amino acids ASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDPSTDYYQELQRDISEM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MUC1 Blocking Peptide, catalog no. 33R-1532, is also available for use as a blocking control in assays to test for specificity of this MUC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MUC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MUC1

Target: MUC1 (Mucin 1 (MUC1))

Andere Bezeichnung: MUC1 (MUC1 Produkte)

Synonyme: CA 15-3 antikoerper, CD227 antikoerper, EMA antikoerper, H23AG antikoerper, KL-6 antikoerper, MAM6 antikoerper, MCKD1 antikoerper, MUC-1 antikoerper, MUC-1/SEC antikoerper, MUC-1/X antikoerper, MUC1/ZD antikoerper, PEM antikoerper, PEMT antikoerper, PUM antikoerper, Muc-1 antikoerper, mucin 1, cell surface associated antikoerper, mucin 1, transmembrane antikoerper, MUC1 antikoerper, Muc1 antikoerper

Hintergrund: MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.

Molekulargewicht: 14 kDa (MW of target protein)

Pathways: Negative Regulation of intrinsic apoptotic Signaling