LRRC26 Antikörper (Middle Region)

Produktnummer ABIN635168

Produktdetails anti-LRRC26 Antikörper

Target: LRRC26 (Leucine Rich Repeat Containing 26 (LRRC26))

Bindungsspezifität: Middle Region

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LRRC26 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LRRC26 antibody was raised against the middle region of Lrrc26

Aufreinigung: Affinity purified

Immunogen: LRRC26 antibody was raised using the middle region of Lrrc26 corresponding to a region with amino acids LRPLCAWLRRHPLPASEAETVLCVWPGRLTLSPLTAFSDAAFSHCAQPLA

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LRRC26 Blocking Peptide, catalog no. 33R-5378, is also available for use as a blocking control in assays to test for specificity of this LRRC26 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC26 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LRRC26

Target: LRRC26 (Leucine Rich Repeat Containing 26 (LRRC26))

Andere Bezeichnung: LRRC26 (LRRC26 Produkte)

Synonyme: LRRC26 antikoerper, CAPC antikoerper, bA350O14.10 antikoerper, RP23-132N23.19 antikoerper, RGD1308398 antikoerper, leucine rich repeat containing 26 antikoerper, LRRC26 antikoerper, Lrrc26 antikoerper

Hintergrund: LRRC26 is an auxiliary protein of the large-conductance, voltage and calcium-activated potassium channel (BK alpha), required for the conversion of BK alpha channels from a high-voltage to a low-voltage activated channel type in non-excitable cells. These are characterized by negative membrane voltages and constant low levels of calcium.

Molekulargewicht: 37 kDa (MW of target protein)