INSIG1 Antikörper (Insulin Induced Gene 1) (Middle Region)

Details for Product anti-INSIG1 Antibody No. ABIN635167
Antigen
Epitop
Middle Region
9
8
8
4
2
2
2
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
40
11
11
7
4
4
4
4
3
3
3
3
2
2
2
1
1
Wirt
Kaninchen
44
Klonalität
Polyklonal
Konjugat
Dieser INSIG1 Antikörper ist unkonjugiert
3
2
2
2
2
2
Applikation
Western Blotting (WB)
41
19
7
3
3
2
1
1
1
Optionen
Immunogen INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH
Spezifität INSIG1 antibody was raised against the middle region of INSIG1
Reinigung Affinity purified
Antigen
Andere Bezeichnung INSIG1 (INSIG1 Antibody Abstract)
Hintergrund Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.
Molekulargewicht 25 kDa (MW of target protein)
Pathways ER-Nucleus Signaling
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

INSIG1 Blocking Peptide, catalog no. 33R-10042, is also available for use as a blocking control in assays to test for specificity of this INSIG1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Insulin Induced Gene 1 (INSIG1) (Middle Region) antibody (ABIN635167) INSIG1 antibody used at 1 ug/ml to detect target protein.