INSIG1 Antikörper (Middle Region)

Produktnummer ABIN635167

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch INSIG1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für INSIG1 Antikörper (Middle Region) (ABIN635167)

Target: INSIG1 (Insulin Induced Gene 1 (INSIG1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser INSIG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-INSIG1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: INSIG1 antibody was raised against the middle region of INSIG1

Aufreinigung: Affinity purified

Immunogen: INSIG1 antibody was raised using the middle region of INSIG1 corresponding to a region with amino acids WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

INSIG1 Blocking Peptide, catalog no. 33R-10042, is also available for use as a blocking control in assays to test for specificity of this INSIG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INSIG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu INSIG1

Target: INSIG1 (Insulin Induced Gene 1 (INSIG1))

Andere Bezeichnung: INSIG1

Hintergrund: Oxysterols regulate cholesterol homeostasis through the liver X receptor (LXR)- and sterol regulatory element-binding protein (SREBP)-mediated signaling pathways. This gene is an insulin-induced gene. INSIG1 is an endoplasmic reticulum (ER) membrane protein that plays a critical role in regulating cholesterol concentrations in cells. INSIG1 binds to the sterol-sensing domains of SREBP cleavage-activating protein (SCAP) and HMG CoA reductase, and is essential for the sterol-mediated trafficking of the two proteins.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling