SPOCK3 Antikörper

Produktnummer ABIN635166

Der Kaninchen Polyklonal anti-SPOCK3 Antikörper (ABIN635166) detektiert spezifisch SPOCK3 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für SPOCK3 Antikörper (ABIN635166)

Target: SPOCK3 (Sparc/osteonectin, Cwcv and Kazal-Like Domains Proteoglycan (Testican) 3 (SPOCK3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPOCK3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SPOCK3 Antikörper

Aufreinigung: Affinity purified

Immunogen: SPOCK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPOCK3 Blocking Peptide, (ABIN937144), is also available for use as a blocking control in assays to test for specificity of this SPOCK3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPOCK3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPOCK3

Target: SPOCK3 (Sparc/osteonectin, Cwcv and Kazal-Like Domains Proteoglycan (Testican) 3 (SPOCK3))

Andere Bezeichnung: SPOCK3

Hintergrund: Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 is a member of a novel Ca(2+)-binding family Proteoglycans, which consist of a core protein and covalently linked glycosaminoglycans, are components of the extracellular matrix. SPOCK3 encodes a member of a novel Ca(2+)-binding proteoglycan family.

Molekulargewicht: 49 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process