TMEM75 Antikörper (C-Term)

Produktnummer ABIN635165

Produktdetails anti-TMEM75 Antikörper

Target: TMEM75 (Transmembrane Protein 75 (TMEM75))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM75 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM75 antibody was raised against the C terminal of TMEM75

Aufreinigung: Affinity purified

Immunogen: TMEM75 antibody was raised using the C terminal of TMEM75 corresponding to a region with amino acids VTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVS

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM75 Blocking Peptide, catalog no. 33R-9846, is also available for use as a blocking control in assays to test for specificity of this TMEM75 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM75 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM75

Target: TMEM75 (Transmembrane Protein 75 (TMEM75))

Andere Bezeichnung: TMEM75 (TMEM75 Produkte)

Synonyme: transmembrane protein 75 antikoerper, TMEM75 antikoerper

Hintergrund: The function of TMEM75 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 15 kDa (MW of target protein)