Chromosome 14 Open Reading Frame 180 (C14orf180) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635161
Antigen
Epitop
N-Term
4
2
1
1
1
Reaktivität
Human
15
1
Wirt
Kaninchen
15
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
10
2
1
1
Optionen
Immunogen C14 ORF180 antibody was raised using the N terminal Of C14 rf180 corresponding to a region with amino acids RTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRS
Spezifität C14 ORF180 antibody was raised against the N terminal Of C14 rf180
Reinigung Affinity purified
Antigen
Andere Bezeichnung C14ORF180
Hintergrund C14orf180 is a multi-pass membrane protein. The function of the C14orf180 protein is not known.
Molekulargewicht 18 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

C14ORF180 Blocking Peptide, catalog no. 33R-8218, is also available for use as a blocking control in assays to test for specificity of this C14ORF180 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF180 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Chromosome 14 Open Reading Frame 180 (C14orf180) (N-Term) antibody (ABIN635161) C14ORF180 antibody used at 1 ug/ml to detect target protein.