C14orf180 Antikörper (N-Term)
-
- Target Alle C14orf180 Produkte
- C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C14orf180 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C14 ORF180 antibody was raised against the N terminal Of C14 rf180
- Aufreinigung
- Affinity purified
- Immunogen
- C14 ORF180 antibody was raised using the N terminal Of C14 rf180 corresponding to a region with amino acids RTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRS
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C14ORF180 Blocking Peptide, catalog no. 33R-8218, is also available for use as a blocking control in assays to test for specificity of this C14ORF180 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF180 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))
- Andere Bezeichnung
- C14ORF180 (C14orf180 Produkte)
- Synonyme
- C14orf77 antikoerper, NRAC antikoerper, Nrac antikoerper, C21H14orf180 antikoerper, chromosome 14 open reading frame 180 antikoerper, RIKEN cDNA A530016L24 gene antikoerper, chromosome 21 open reading frame, human C14orf180 antikoerper, C14orf180 antikoerper, A530016L24Rik antikoerper, C21H14orf180 antikoerper
- Hintergrund
- C14orf180 is a multi-pass membrane protein. The function of the C14orf180 protein is not known.
- Molekulargewicht
- 18 kDa (MW of target protein)
-