C14orf180 Antikörper (N-Term)

Produktnummer ABIN635161

Dieser Kaninchen Polyklonal Antikörper erkennt spezifisch C14orf180 in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für C14orf180 Antikörper (N-Term) (ABIN635161)

Target: C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C14orf180 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-C14orf180 Antikörper

Bindungsspezifität: N-Term

Spezifität: C14 ORF180 antibody was raised against the N terminal Of C14 rf180

Aufreinigung: Affinity purified

Immunogen: C14 ORF180 antibody was raised using the N terminal Of C14 rf180 corresponding to a region with amino acids RTAAGAVSPDSRPETRRQTRKNEEAAWGPRVCRAEREDNRKCPPSILKRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C14ORF180 Blocking Peptide, (ABIN5612413), is also available for use as a blocking control in assays to test for specificity of this C14ORF180 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF180 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C14orf180

Target: C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))

Andere Bezeichnung: C14ORF180

Hintergrund: C14orf180 is a multi-pass membrane protein. The function of the C14orf180 protein is not known.

Molekulargewicht: 18 kDa (MW of target protein)