PANX1 Antikörper (Middle Region)

Produktnummer ABIN635152

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch PANX1 in WB und IHC. Es zeigt Reaktivität gegenüber Proben von Säugetier.

Kurzübersicht für PANX1 Antikörper (Middle Region) (ABIN635152)

Target: PANX1 (Pannexin 1 (PANX1))

Reaktivität: Säugetier

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PANX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PANX1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Pannexin 1 antibody was raised against the middle region of PANX1

Kreuzreaktivität: Human

Aufreinigung: Affinity purified

Immunogen: Pannexin 1 antibody was raised using the middle region of PANX1 corresponding to a region with amino acids LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Pannexin 1 Blocking Peptide, (ABIN940391), is also available for use as a blocking control in assays to test for specificity of this Pannexin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PANX1

Target: PANX1 (Pannexin 1 (PANX1))

Andere Bezeichnung: Pannexin 1

Hintergrund: PANX1 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.

Molekulargewicht: 47 kDa (MW of target protein)