PANX1 Antikörper (Middle Region)

Produktnummer ABIN635152

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch PANX1 in WB und IHC. Er zeigt eine Reaktivität gegenüber Säugetier.

Kurzübersicht für PANX1 Antikörper (Middle Region) (ABIN635152)

Target: PANX1 (Pannexin 1 (PANX1))

Reaktivität: Säugetier

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PANX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-PANX1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: Pannexin 1 antibody was raised against the middle region of PANX1

Kreuzreaktivität: Human

Aufreinigung: Affinity purified

Immunogen: Pannexin 1 antibody was raised using the middle region of PANX1 corresponding to a region with amino acids LGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVIN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Pannexin 1 Blocking Peptide, (ABIN940391), is also available for use as a blocking control in assays to test for specificity of this Pannexin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PANX1

Target: PANX1 (Pannexin 1 (PANX1))

Andere Bezeichnung: Pannexin 1

Hintergrund: PANX1 belongs to the innexin family. Innexin family members are the structural components of gap junctions. This protein and pannexin 2 are abundantly expressed in central nerve system (CNS) and are coexpressed in various neuronal populations. Studies in Xenopus oocytes suggest that this protein alone and in combination with pannexin 2 may form cell type-specific gap junctions with distinct properties.

Molekulargewicht: 47 kDa (MW of target protein)