Leucine Rich Repeat Containing 4C (LRRC4C) (N-Term) Antikörper

Details zu Produkt Nr. ABIN635150
Antigen
Epitop
N-Term
9
7
7
7
4
2
1
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
52
33
24
2
2
2
2
2
2
1
1
1
1
Wirt
Kaninchen
48
6
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
5
4
4
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
37
27
13
10
3
2
1
Optionen
Immunogen LRRC4 C antibody was raised using the N terminal of LRRC4 corresponding to a region with amino acids LVVAGLVRAQTCPSVCSCSNQFSKVICVRKNLREVPDGISTNTRLLNLHE
Spezifität LRRC4 C antibody was raised against the N terminal of LRRC4
Reinigung Affinity purified
Antigen
Andere Bezeichnung LRRC4C (LRRC4C Antibody Abstract)
Hintergrund NGL1 (LRRC4C) is a specific binding partner for netrin G1 (NTNG1), which is a member of the netrin family of axon guidance molecules. It may promote neurite outgrowth of developing thalamic neurons.
Molekulargewicht 72 kDa (MW of target protein)
Pathways Synaptic Membrane
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

LRRC4C Blocking Peptide, catalog no. 33R-5546, is also available for use as a blocking control in assays to test for specificity of this LRRC4C antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC0 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Leucine Rich Repeat Containing 4C (LRRC4C) (N-Term) antibody (ABIN635150) LRRC4C antibody used at 1 ug/ml to detect target protein.