DNAJC10 Antikörper

Produktnummer ABIN635149

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch DNAJC10 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für DNAJC10 Antikörper (ABIN635149)

Target: DNAJC10 (DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNAJC10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DNAJC10 Antikörper

Aufreinigung: Affinity purified

Immunogen: DNAJC10 antibody was raised using a synthetic peptide corresponding to a region with amino acids DFYSLLGVSKTASSREIRQAFKKLALKLHPDKNPNNPNAHGDFLKINRAY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNAJC10 Blocking Peptide, (ABIN937327), is also available for use as a blocking control in assays to test for specificity of this DNAJC10 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJC10 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNAJC10

Target: DNAJC10 (DnaJ (Hsp40) Homolog, Subfamily C, Member 10 (DNAJC10))

Andere Bezeichnung: DNAJC10

Hintergrund: This endoplasmic reticulum co-chaperone may play a role in protein folding and translocation across the endoplasmic reticulum membrane. DNAJC10 may act as a co-chaperone for HSPA5.

Molekulargewicht: 91 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis