TMEM144 Antikörper (Middle Region)

Produktnummer ABIN635148

Produktdetails anti-TMEM144 Antikörper

Target: TMEM144 (Transmembrane Protein 144 (TMEM144))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM144 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM144 antibody was raised against the middle region of TMEM144

Aufreinigung: Affinity purified

Immunogen: TMEM144 antibody was raised using the middle region of TMEM144 corresponding to a region with amino acids LSTVHHRIVGCSLAVISGVLYGSTFVPIIYIKDHSKRNDSIYAGASQYDL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM144 Blocking Peptide, catalog no. 33R-5463, is also available for use as a blocking control in assays to test for specificity of this TMEM144 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM144 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM144

Target: TMEM144 (Transmembrane Protein 144 (TMEM144))

Andere Bezeichnung: TMEM144 (TMEM144 Produkte)

Synonyme: tmem144 antikoerper, zgc:100814 antikoerper, 1110057I03Rik antikoerper, 5730537D05Rik antikoerper, RGD1565845 antikoerper, transmembrane protein 144 antikoerper, transmembrane protein 144a antikoerper, transmembrane protein 144 L homeolog antikoerper, TMEM144 antikoerper, tmem144a antikoerper, tmem144 antikoerper, tmem144.L antikoerper, Tmem144 antikoerper

Hintergrund: The function of the TMEM144 protein remains unknown.

Molekulargewicht: 38 kDa (MW of target protein)