TMEM144 Antikörper (Middle Region)

Produktnummer ABIN635148

Dieses Anti-TMEM144-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von TMEM144 in WB. Geeignet für Human und Ratte.

Kurzübersicht für TMEM144 Antikörper (Middle Region) (ABIN635148)

Target: TMEM144 (Transmembrane Protein 144 (TMEM144))

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM144 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-TMEM144 Antikörper

Bindungsspezifität: Middle Region

Spezifität: TMEM144 antibody was raised against the middle region of TMEM144

Aufreinigung: Affinity purified

Immunogen: TMEM144 antibody was raised using the middle region of TMEM144 corresponding to a region with amino acids LSTVHHRIVGCSLAVISGVLYGSTFVPIIYIKDHSKRNDSIYAGASQYDL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM144 Blocking Peptide, (ABIN5616665), is also available for use as a blocking control in assays to test for specificity of this TMEM144 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM144 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM144

Target: TMEM144 (Transmembrane Protein 144 (TMEM144))

Andere Bezeichnung: TMEM144

Hintergrund: The function of the TMEM144 protein remains unknown.

Molekulargewicht: 38 kDa (MW of target protein)