TMEM206 Antikörper (N-Term)
-
- Target Alle TMEM206 (C1orf75) Produkte
- TMEM206 (C1orf75) (Transmembrane Protein 206 (C1orf75))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM206 Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Spezifität
- C1 ORF75 antibody was raised against the N terminal Of C1 rf75
- Aufreinigung
- Affinity purified
- Immunogen
- C1 ORF75 antibody was raised using the N terminal Of C1 rf75 corresponding to a region with amino acids IFIYLLLMAVAVFLVYRTITDFREKLKHPVMSVSYKEVDRYDAPGIALYP
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C1ORF75 Blocking Peptide, catalog no. 33R-3958, is also available for use as a blocking control in assays to test for specificity of this C1ORF75 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF75 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM206 (C1orf75) (Transmembrane Protein 206 (C1orf75))
- Andere Bezeichnung
- C1ORF75 (C1orf75 Produkte)
- Synonyme
- C1orf75 antikoerper, RP11-384C4.5 antikoerper, 2310028N02Rik antikoerper, AI118576 antikoerper, RGD1359339 antikoerper, C16H1orf75 antikoerper, transmembrane protein 206 antikoerper, transmembrane protein 206 L homeolog antikoerper, TMEM206 antikoerper, Tmem206 antikoerper, tmem206.L antikoerper
- Hintergrund
- The function of Chromosome 1 ORF protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 40 kDa (MW of target protein)
-