UNC50 Antikörper (Unc-50 Homolog (C. Elegans))

Details for Product anti-UNC50 Antibody No. ABIN635144
Antigen
Reaktivität
Human, Maus, Ratte (Rattus)
8
3
3
1
1
1
1
1
1
Wirt
Kaninchen
8
Klonalität
Polyklonal
Konjugat
Dieser UNC50 Antikörper ist unkonjugiert
1
1
1
Applikation
Western Blotting (WB)
5
4
1
1
Optionen
Immunogen UNC50 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW
Reinigung Affinity purified
Antigen
Andere Bezeichnung UNC50
Hintergrund UNC50 belongs to the unc-50 family. It binds RNA. UNC50 may be involved in cell surface expression of neuronal nicotinic receptors.
Molekulargewicht 30 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

UNC50 Blocking Peptide, catalog no. 33R-5291, is also available for use as a blocking control in assays to test for specificity of this UNC50 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC50 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Unc-50 Homolog (C. Elegans) (UNC50) antibody (ABIN635144) UNC50 antibody used at 1 ug/ml to detect target protein.