UNC50 Antikörper

Produktnummer ABIN635144

Der Kaninchen Polyklonal Anti-UNC50-Antikörper wurde für WB validiert. Er ist geeignet, UNC50 in Proben von Human, Maus und Ratte zu detektieren.

Kurzübersicht für UNC50 Antikörper (ABIN635144)

Target: UNC50 (Unc-50 Homolog (UNC50))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UNC50 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-UNC50 Antikörper

Aufreinigung: Affinity purified

Immunogen: UNC50 antibody was raised using a synthetic peptide corresponding to a region with amino acids LPSTSVNSLVQGNGVLNSRDAARHTAGAKRYKYLRRLFRFRQMDFEFAAW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UNC50 Blocking Peptide, (ABIN5616910), is also available for use as a blocking control in assays to test for specificity of this UNC50 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC50 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UNC50

Target: UNC50 (Unc-50 Homolog (UNC50))

Andere Bezeichnung: UNC50

Hintergrund: UNC50 belongs to the unc-50 family. It binds RNA. UNC50 may be involved in cell surface expression of neuronal nicotinic receptors.

Molekulargewicht: 30 kDa (MW of target protein)