Acsl3 Antikörper (Acyl-CoA Synthetase Long-Chain Family Member 3) (N-Term)

Details for Product anti-Acsl3 Antibody No. ABIN635143
Antigen
Epitop
N-Term
15
11
11
8
8
7
1
1
1
1
1
Reaktivität
Human, Maus
76
9
5
1
1
1
1
1
1
1
Wirt
Kaninchen
72
4
Klonalität
Polyklonal
Konjugat
Dieser Acsl3 Antikörper ist unkonjugiert
5
4
4
4
4
4
1
1
1
1
1
1
Applikation
Western Blotting (WB)
70
44
21
7
6
2
1
1
1
Optionen
Immunogen ACSL3 antibody was raised using the N terminal of ACSL3 corresponding to a region with amino acids LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI
Spezifität ACSL3 antibody was raised against the N terminal of ACSL3
Reinigung Affinity purified
Antigen
Andere Bezeichnung ACSL3 (Acsl3 Antibody Abstract)
Hintergrund ACSL3 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates.
Molekulargewicht 80 kDa (MW of target protein)
Pathways SARS-CoV-2 Protein Interaktom
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

ACSL3 Blocking Peptide, catalog no. 33R-4845, is also available for use as a blocking control in assays to test for specificity of this ACSL3 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL3 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3) (N-Term) antibody (ABIN635143) ACSL3 antibody used at 1 ug/ml to detect target protein.