Acsl3 Antikörper (N-Term)

Produktnummer ABIN635143

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch Acsl3 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für Acsl3 Antikörper (N-Term) (ABIN635143)

Target: Acsl3 (Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Acsl3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Acsl3 Antikörper

Bindungsspezifität: N-Term

Spezifität: ACSL3 antibody was raised against the N terminal of ACSL3

Aufreinigung: Affinity purified

Immunogen: ACSL3 antibody was raised using the N terminal of ACSL3 corresponding to a region with amino acids LDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGTREVLNEEDEVQPNGKI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACSL3 Blocking Peptide, (ABIN940231), is also available for use as a blocking control in assays to test for specificity of this ACSL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Acsl3

Target: Acsl3 (Acyl-CoA Synthetase Long-Chain Family Member 3 (Acsl3))

Andere Bezeichnung: ACSL3

Hintergrund: ACSL3 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in brain, and preferentially utilizes myristate, arachidonate, and eicosapentaenoate as substrates.

Molekulargewicht: 80 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom