Synaptophysin Antikörper (SYP) (N-Term)

Details for Product anti-SYP Antibody No. ABIN635142
Antigen
Epitop
N-Term
40
10
8
7
3
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
234
117
103
28
11
9
6
6
4
2
2
2
1
1
1
1
1
1
Wirt
Kaninchen
153
126
6
1
Klonalität
Polyklonal
Konjugat
Dieser Synaptophysin Antikörper ist unkonjugiert
7
5
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
231
155
76
57
53
29
25
16
8
7
6
4
3
3
3
1
Optionen
Immunogen Synaptophysin antibody was raised using the N terminal of SYP corresponding to a region with amino acids MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE
Spezifität Synaptophysin antibody was raised against the N terminal of SYP
Reinigung Affinity purified
Antigen
Andere Bezeichnung Synaptophysin (SYP Antibody Abstract)
Hintergrund Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.
Molekulargewicht 34 kDa (MW of target protein)
Pathways Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of long-term Neuronal Synaptic Plasticity
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

Synaptophysin Blocking Peptide, catalog no. 33R-6191, is also available for use as a blocking control in assays to test for specificity of this Synaptophysin antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYP antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Synaptophysin (SYP) (N-Term) antibody (ABIN635142) Synaptophysin antibody used at a concentration of 10 ug/ml to detect synaptic puncta ...
Image no. 2 for anti-Synaptophysin (SYP) (N-Term) antibody (ABIN635142) Synaptophysin antibody used at 1 ug/ml to detect target protein.