Synaptophysin Antikörper (N-Term)

Produktnummer ABIN635142

Dieses Anti-Synaptophysin-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von Synaptophysin in WB. Geeignet für Human, Ratte und Maus.

Kurzübersicht für Synaptophysin Antikörper (N-Term) (ABIN635142)

Target: Synaptophysin (SYP)

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Synaptophysin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Synaptophysin Antikörper

Bindungsspezifität: N-Term

Spezifität: Synaptophysin antibody was raised against the N terminal of SYP

Aufreinigung: Affinity purified

Immunogen: Synaptophysin antibody was raised using the N terminal of SYP corresponding to a region with amino acids MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Synaptophysin Blocking Peptide, catalog no. 33R-6191, is also available for use as a blocking control in assays to test for specificity of this Synaptophysin antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Synaptophysin

Target: Synaptophysin (SYP)

Andere Bezeichnung: Synaptophysin

Hintergrund: Synaptophysin (p38) is an integral membrane protein of small synaptic vesicles in brain and endocrine cells.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Regulation of G-Protein Coupled Receptor Protein Signaling, Regulation of long-term Neuronal Synaptic Plasticity