Slc6a14 Antikörper
-
- Target Alle Slc6a14 Antikörper anzeigen
- Slc6a14 (Solute Carrier Family 6 (Amino Acid Transporter), Member 14 (Slc6a14))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Slc6a14 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC6 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFW
- Top Product
- Discover our top product Slc6a14 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC6A14 Blocking Peptide, catalog no. 33R-9518, is also available for use as a blocking control in assays to test for specificity of this SLC6A14 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 14 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Slc6a14 (Solute Carrier Family 6 (Amino Acid Transporter), Member 14 (Slc6a14))
- Andere Bezeichnung
- SLC6A14 (Slc6a14 Produkte)
- Hintergrund
- This gene encodes a member of the solute carrier family 6. Members of this family are sodium and chloride dependent neurotransmitter transporters. The encoded protein transports both neutral and cationic amino acids.
- Molekulargewicht
- 72 kDa (MW of target protein)
-