Slc6a14 Antikörper (Solute Carrier Family 6 (Amino Acid Transporter), Member 14)

Details for Product anti-Slc6a14 Antibody No. ABIN635141
Antigen
Reaktivität
Human
39
4
4
4
2
2
2
1
1
1
Wirt
Kaninchen
39
Klonalität
Polyklonal
Konjugat
Dieser Slc6a14 Antikörper ist unkonjugiert
3
2
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
33
18
18
7
2
1
Optionen
Immunogen SLC6 A14 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFW
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC6A14 (Slc6a14 Antibody Abstract)
Hintergrund This gene encodes a member of the solute carrier family 6. Members of this family are sodium and chloride dependent neurotransmitter transporters. The encoded protein transports both neutral and cationic amino acids.
Molekulargewicht 72 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC6A14 Blocking Peptide, catalog no. 33R-9518, is also available for use as a blocking control in assays to test for specificity of this SLC6A14 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 14 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 6 (Amino Acid Transporter), Member 14 (Slc6a14) antibody (ABIN635141) SLC6A14 antibody used at 1 ug/ml to detect target protein.