beta-Site APP-Cleaving Enzyme 2 (BACE2) (Middle Region) Antikörper

Details zu Produkt Nr. ABIN635132
Antigen
Epitop
Middle Region
20
15
15
11
10
8
7
7
4
4
4
3
3
2
2
1
1
1
1
1
1
1
1
Reaktivität
Human
122
51
45
4
3
2
2
2
2
1
1
1
1
Wirt
Kaninchen
130
2
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
12
9
4
4
4
4
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
114
58
43
19
18
13
7
4
4
3
2
Optionen
Immunogen BACE2 antibody was raised using the middle region of BACE2 corresponding to a region with amino acids SLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGF
Spezifität BACE2 antibody was raised against the middle region of BACE2
Reinigung Affinity purified
Antigen
Andere Bezeichnung BACE2 (BACE2 Antibody Abstract)
Hintergrund Cerebral deposition of amyloid beta peptide is an early and critical feature of Alzheimer's disease and a frequent complication of Down syndrome. Amyloid beta peptide is generated by proteolytic cleavage of amyloid precursor protein by 2 proteases, one of which is the protein encoded by this gene. This gene localizes to the 'Down critical region' of chromosome 21. The encoded protein, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease. Three transcript variants encoding different isoforms have been described for this gene.
Molekulargewicht 37 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

BACE2 Blocking Peptide, catalog no. 33R-8612, is also available for use as a blocking control in assays to test for specificity of this BACE2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BACE2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-beta-Site APP-Cleaving Enzyme 2 (BACE2) (Middle Region) antibody (ABIN635132) BACE2 antibody used at 1 ug/ml to detect target protein.