ACSL5 Antikörper (C-Term)

Produktnummer ABIN635129

Produktdetails anti-ACSL5 Antikörper

Target: ACSL5 (Acyl-CoA Synthetase Long-Chain Family Member 5 (ACSL5))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACSL5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACSL5 antibody was raised against the C terminal of ACSL5

Aufreinigung: Affinity purified

Immunogen: ACSL5 antibody was raised using the C terminal of ACSL5 corresponding to a region with amino acids ACNYVKLEDVADMNYFTVNNEGEVCIKGTNVFKGYLKDPEKTQEALDSDG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACSL5 Blocking Peptide, catalog no. 33R-1075, is also available for use as a blocking control in assays to test for specificity of this ACSL5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACSL5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACSL5

Target: ACSL5 (Acyl-CoA Synthetase Long-Chain Family Member 5 (ACSL5))

Andere Bezeichnung: ACSL5 (ACSL5 Produkte)

Synonyme: ACSL5 antikoerper, acs2 antikoerper, acs5 antikoerper, facl5 antikoerper, ACS2 antikoerper, ACS5 antikoerper, FACL5 antikoerper, 1700030F05Rik antikoerper, Facl5 antikoerper, Acs5 antikoerper, zgc:92083 antikoerper, acyl-CoA synthetase long chain family member 5 antikoerper, acyl-CoA synthetase long-chain family member 5 antikoerper, ACSL5 antikoerper, acsl5 antikoerper, Acsl5 antikoerper

Hintergrund: ASCL5 is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

Molekulargewicht: 76 kDa (MW of target protein)