SPTLC1 Antikörper (Middle Region)

Produktnummer ABIN635127

Zitiert in 1 Publikation. Der Kaninchen Polyklonal anti-SPTLC1 Antikörper (ABIN635127) detektiert spezifisch SPTLC1 in WB und IHC. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für SPTLC1 Antikörper (Middle Region) (ABIN635127)

Target: SPTLC1 (serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPTLC1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Produktdetails anti-SPTLC1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SPTLC1 antibody was raised against the middle region of SPTLC1

Aufreinigung: Affinity purified

Immunogen: SPTLC1 antibody was raised using the middle region of SPTLC1 corresponding to a region with amino acids ICPLPELVKLKYKYKARIFLEESLSFGVLGEHGRGVTEHYGINIDDIDLI

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPTLC1 Blocking Peptide, (ABIN939291), is also available for use as a blocking control in assays to test for specificity of this SPTLC1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPTLC1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen für anti-SPTLC1 Antikörper (ABIN635127)

Klas, Copic, Direder, Laggner, Prucksamas, Gruber, Ankersmit, Mildner: "Transcriptional Differences in Lipid-Metabolizing Enzymes in Murine Sebocytes Derived from Sebaceous Glands of the Skin and Preputial Glands." in: International journal of molecular sciences, Vol. 22, Issue 21, (2021) (PubMed).

Details zu SPTLC1

Target: SPTLC1 (serine Palmitoyltransferase, Long Chain Base Subunit 1 (SPTLC1))

Andere Bezeichnung: SPTLC1

Hintergrund: Serine palmitoyltransferase, which consists of two different subunits, is the key enzyme in sphingolipid biosynthesis. It converts L-serine and palmitoyl-CoA to 3-oxosphinganine with pyridoxal 5'-phosphate as a cofactor. SPTLC1 is the long chain base subunit 1 of serine palmitoyltransferase. Mutations in SPTLC1 gene were identified in patients with hereditary sensory neuropathy type 1.

Molekulargewicht: 53 kDa (MW of target protein)