GDAP1L1 Antikörper (N-Term)

Produktnummer ABIN635125

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch GDAP1L1 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für GDAP1L1 Antikörper (N-Term) (ABIN635125)

Target: GDAP1L1 (Ganglioside-Induced Differentiation-Associated Protein 1-Like 1 (GDAP1L1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GDAP1L1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GDAP1L1 Antikörper

Bindungsspezifität: N-Term

Spezifität: GDAP1 L1 antibody was raised against the N terminal of GDAP1 1

Aufreinigung: Affinity purified

Immunogen: GDAP1 L1 antibody was raised using the N terminal of GDAP1 1 corresponding to a region with amino acids ERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GDAP1L1 Blocking Peptide, (ABIN938075), is also available for use as a blocking control in assays to test for specificity of this GDAP1L1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GDAP0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GDAP1L1

Target: GDAP1L1 (Ganglioside-Induced Differentiation-Associated Protein 1-Like 1 (GDAP1L1))

Andere Bezeichnung: GDAP1L1

Hintergrund: The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1). A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. GDAP1L1 is similar in sequence to the human GDAP1 protein.

Molekulargewicht: 42 kDa (MW of target protein)