ANO3 Antikörper (Anoctamin 3) (C-Term)

Details for Product anti-ANO3 Antibody No. ABIN635122
Antigen
Epitop
C-Term
4
3
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
31
26
21
3
3
3
3
2
2
2
2
1
Wirt
Kaninchen
32
Klonalität
Polyklonal
Konjugat
Dieser ANO3 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
19
13
5
4
2
1
Optionen
Immunogen TMEM16 C antibody was raised using the C terminal of TMEM16 corresponding to a region with amino acids AFVIAITSDYIPRFVYEYKYGPCANHVEPSENCLKGYVNNSLSFFDLSEL
Spezifität TMEM16 C antibody was raised against the C terminal of TMEM16
Reinigung Affinity purified
Antigen
Andere Bezeichnung TMEM16C (ANO3 Antibody Abstract)
Hintergrund TMEM16C is a multi-pass membrane proteinPotential. It belongs to the anoctamin family. TMEM16C may act as a calcium-activated chloride channel.
Molekulargewicht 115 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

TMEM16C Blocking Peptide, catalog no. 33R-1181, is also available for use as a blocking control in assays to test for specificity of this TMEM16C antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM10 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Anoctamin 3 (ANO3) (C-Term) antibody (ABIN635122) TMEM16C antibody used at 1 ug/ml to detect target protein.