SLC15A4 Antikörper (Middle Region)

Produktnummer ABIN635120

Produktdetails anti-SLC15A4 Antikörper

Target: SLC15A4 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 4 (SLC15A4))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC15A4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC15 A4 antibody was raised against the middle region of SLC15 4

Aufreinigung: Affinity purified

Immunogen: SLC15 A4 antibody was raised using the middle region of SLC15 4 corresponding to a region with amino acids GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC15A4 Blocking Peptide, catalog no. 33R-3409, is also available for use as a blocking control in assays to test for specificity of this SLC15A4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC15A4

Target: SLC15A4 (Solute Carrier Family 15 (H+/Peptide Transporter), Member 4 (SLC15A4))

Andere Bezeichnung: SLC15A4 (SLC15A4 Produkte)

Hintergrund: SLC15A4 is a proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides.

Molekulargewicht: 62 kDa (MW of target protein)