SLC15A4 Antikörper (Solute Carrier Family 15 (H+/Peptide Transporter), Member 4) (Middle Region)

Details for Product anti-SLC15A4 Antibody No. ABIN635120
Target
Bindungsspezifität
Middle Region
1
1
1
Reaktivität
Human
5
1
1
1
1
1
1
1
1
Wirt
Kaninchen
5
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
5
2
1
1
Optionen
Immunogen SLC15 A4 antibody was raised using the middle region of SLC15 4 corresponding to a region with amino acids GLLPSSLKRIAVGMFFVMCSAFAAGILESKRLNLVKEKTINQTIGNVVYH
Spezifität SLC15 A4 antibody was raised against the middle region of SLC15 4
Reinigung Affinity purified
Target
Andere Bezeichnung SLC15A4 (SLC15A4 Antibody Abstract)
Hintergrund SLC15A4 is a proton oligopeptide cotransporter. It transports free histidine and certain di- and tripeptides.
Molekulargewicht 62 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC15A4 Blocking Peptide, catalog no. 33R-3409, is also available for use as a blocking control in assays to test for specificity of this SLC15A4 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 4 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder
Image no. 1 for anti-Solute Carrier Family 15 (H+/Peptide Transporter), Member 4 (SLC15A4) (Middle Region) antibody (ABIN635120) SLC15A4 antibody used at 1 ug/ml to detect target protein.