DIRC2 Antikörper (Middle Region)

Produktnummer ABIN635117

Der Kaninchen Polyklonal Anti-DIRC2-Antikörper wurde für WB validiert. Er ist geeignet, DIRC2 in Proben von Human und Maus zu detektieren.

Kurzübersicht für DIRC2 Antikörper (Middle Region) (ABIN635117)

Target: DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DIRC2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DIRC2 Antikörper

Bindungsspezifität: Middle Region

Spezifität: DIRC2 antibody was raised against the middle region of DIRC2

Aufreinigung: Affinity purified

Immunogen: DIRC2 antibody was raised using the middle region of DIRC2 corresponding to a region with amino acids AAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DIRC2 Blocking Peptide, (ABIN936149), is also available for use as a blocking control in assays to test for specificity of this DIRC2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DIRC2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DIRC2

Target: DIRC2 (Disrupted in Renal Carcinoma 2 (DIRC2))

Andere Bezeichnung: DIRC2

Hintergrund: DIRC2 is a membrane-bound protein from the major facilitator superfamily of transporters. Disruption of DIRC2 by translocation has been associated with haplo-insufficiency and renal cell carcinomas. Alternatively spliced transcript variants have been described, but their biological validity has not yet been determined.

Molekulargewicht: 52 kDa (MW of target protein)