OR10X1 Antikörper (Olfactory Receptor, Family 10, Subfamily X, Member 1) (Middle Region)

Details for Product anti-OR10X1 Antibody No. ABIN635112
Antigen
Epitop
Middle Region
10
8
8
7
3
2
2
2
1
1
Reaktivität
Human, Ratte (Rattus)
40
14
3
2
2
2
2
2
1
Wirt
Kaninchen
40
Klonalität
Polyklonal
Konjugat
Dieser OR10X1 Antikörper ist unkonjugiert
3
2
2
2
2
2
1
1
1
1
1
1
Applikation
Western Blotting (WB)
34
27
8
2
1
1
1
1
Optionen
Immunogen OR10 X1 antibody was raised using the middle region of OR10 1 corresponding to a region with amino acids NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP
Spezifität OR10 X1 antibody was raised against the middle region of OR10 1
Reinigung Affinity purified
Antigen
Andere Bezeichnung OR10X1 (OR10X1 Antibody Abstract)
Hintergrund OR10X1 is an odorant receptor.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Molekulargewicht 36 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

OR10X1 Blocking Peptide, catalog no. 33R-6728, is also available for use as a blocking control in assays to test for specificity of this OR10X1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR10 1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Olfactory Receptor, Family 10, Subfamily X, Member 1 (OR10X1) (Middle Region) antibody (ABIN635112) OR10X1 antibody used at 1 ug/ml to detect target protein.