OR10X1 Antikörper (Middle Region)

Produktnummer ABIN635112

Produktdetails anti-OR10X1 Antikörper

Target: OR10X1 (Olfactory Receptor, Family 10, Subfamily X, Member 1 (OR10X1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OR10X1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OR10 X1 antibody was raised against the middle region of OR10 1

Aufreinigung: Affinity purified

Immunogen: OR10 X1 antibody was raised using the middle region of OR10 1 corresponding to a region with amino acids NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OR10X1 Blocking Peptide, catalog no. 33R-6728, is also available for use as a blocking control in assays to test for specificity of this OR10X1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR10 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OR10X1

Target: OR10X1 (Olfactory Receptor, Family 10, Subfamily X, Member 1 (OR10X1))

Andere Bezeichnung: OR10X1 (OR10X1 Produkte)

Synonyme: OR1-13 antikoerper, OR1-14 antikoerper, OR10X1P antikoerper, olfactory receptor family 10 subfamily X member 1 (gene/pseudogene) antikoerper, OR10X1 antikoerper

Hintergrund: OR10X1 is an odorant receptor.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.

Molekulargewicht: 36 kDa (MW of target protein)