OR10X1 Antikörper (Middle Region)
-
- Target Alle OR10X1 Antikörper anzeigen
- OR10X1 (Olfactory Receptor, Family 10, Subfamily X, Member 1 (OR10X1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OR10X1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OR10 X1 antibody was raised against the middle region of OR10 1
- Aufreinigung
- Affinity purified
- Immunogen
- OR10 X1 antibody was raised using the middle region of OR10 1 corresponding to a region with amino acids NIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPSDLPYMGSYHAHP
- Top Product
- Discover our top product OR10X1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OR10X1 Blocking Peptide, catalog no. 33R-6728, is also available for use as a blocking control in assays to test for specificity of this OR10X1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OR10 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OR10X1 (Olfactory Receptor, Family 10, Subfamily X, Member 1 (OR10X1))
- Andere Bezeichnung
- OR10X1 (OR10X1 Produkte)
- Hintergrund
- OR10X1 is an odorant receptor.Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
- Molekulargewicht
- 36 kDa (MW of target protein)
-