SLC46A1 Antikörper

Produktnummer ABIN635109

Produktdetails anti-SLC46A1 Antikörper

Target: SLC46A1 (Solute Carrier Family 46 (Folate Transporter), Member 1 (SLC46A1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC46A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC46 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGSASPPEKPRARPAAAVLCRGPVEPLVFLANFALVLQGPLTTQYLWHR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC46A1 Blocking Peptide, catalog no. 33R-5921, is also available for use as a blocking control in assays to test for specificity of this SLC46A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC40 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC46A1

Target: SLC46A1 (Solute Carrier Family 46 (Folate Transporter), Member 1 (SLC46A1))

Andere Bezeichnung: SLC46A1 (SLC46A1 Produkte)

Synonyme: G21 antikoerper, HCP1 antikoerper, PCFT antikoerper, RGD1309472 antikoerper, TRPE antikoerper, 1110002C08Rik antikoerper, D11Ertd18e antikoerper, Pcft antikoerper, solute carrier family 46 member 1 antikoerper, solute carrier family 46 (folate transporter), member 1 antikoerper, solute carrier family 46, member 1 antikoerper, SLC46A1 antikoerper, slc46a1 antikoerper, Slc46a1 antikoerper

Hintergrund: This gene encodes a transmembrane proton-coupled folate transporter protein that facilitates the movement of folate and antifolate substrates across cell membranes optimally in acidic pH environments.

Molekulargewicht: 50 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Dicarboxylic Acid Transport