SLC18A2 Antikörper
-
- Target Alle SLC18A2 Antikörper anzeigen
- SLC18A2 (Solute Carrier Family 18 (Vesicular Monoamine Transporter), Member 2 (SLC18A2))
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC18A2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC18 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
- Top Product
- Discover our top product SLC18A2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC18A2 Blocking Peptide, catalog no. 33R-6646, is also available for use as a blocking control in assays to test for specificity of this SLC18A2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC18A2 (Solute Carrier Family 18 (Vesicular Monoamine Transporter), Member 2 (SLC18A2))
- Andere Bezeichnung
- SLC18A2 (SLC18A2 Produkte)
- Hintergrund
- The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.
- Molekulargewicht
- 56 kDa (MW of target protein)
-