Solute Carrier Family 18 (Vesicular Monoamine Transporter), Member 2 (SLC18A2) Antikörper

Details zu Produkt Nr. ABIN635107
Antigen
Reaktivität
Human, Maus
56
33
31
3
3
2
2
2
1
1
Wirt
Kaninchen
48
8
8
3
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
2
2
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
53
29
28
8
6
5
4
3
1
Optionen
Immunogen SLC18 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NATRDLTLHQTATQHMVTNASAVPSDCPSEDKDLLNENVQVGLLFASKAT
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC18A2 (SLC18A2 Antibody Abstract)
Hintergrund The vesicular monoamine transporter acts to accumulate cytosolic monoamines into synaptic vesicles, using the proton gradient maintained across the synaptic vesicular membrane. Its proper function is essential to the correct activity of the monoaminergic systems that have been implicated in several human neuropsychiatric disorders. The transporter is a site of action of important drugs, including reserpine and tetrabenazine.
Molekulargewicht 56 kDa (MW of target protein)
Applikations-hinweise WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC18A2 Blocking Peptide, catalog no. 33R-6646, is also available for use as a blocking control in assays to test for specificity of this SLC18A2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 18 (Vesicular Monoamine Transporter), Member 2 (SLC18A2) antibody (ABIN635107) SLC18A2 (VMAT2) in the cortex of human brain was detected using SLC18A2 antibody at a...
Image no. 2 for anti-Solute Carrier Family 18 (Vesicular Monoamine Transporter), Member 2 (SLC18A2) antibody (ABIN635107) SLC18A2 antibody used at 0.5 ug/ml to detect target protein.