MFSD1 Antikörper (Middle Region)

Produktnummer ABIN635106

Der Kaninchen Polyklonal anti-MFSD1 Antikörper (ABIN635106) detektiert spezifisch MFSD1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für MFSD1 Antikörper (Middle Region) (ABIN635106)

Target: MFSD1 (Major Facilitator Superfamily Domain Containing 1 (MFSD1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MFSD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MFSD1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: MFSD1 antibody was raised against the middle region of MFSD1

Aufreinigung: Affinity purified

Immunogen: MFSD1 antibody was raised using the middle region of MFSD1 corresponding to a region with amino acids RFVFGIGGESLAVAQNTYAVSWFKGKELNLVFGLQLSMARIGSTVNMNLM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MFSD1 Blocking Peptide, (ABIN5614741), is also available for use as a blocking control in assays to test for specificity of this MFSD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFSD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MFSD1

Target: MFSD1 (Major Facilitator Superfamily Domain Containing 1 (MFSD1))

Andere Bezeichnung: MFSD1

Hintergrund: The function of MFSD1 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 51 kDa (MW of target protein)