IL22 Receptor alpha 1 Antikörper (Interleukin 22 Receptor, alpha 1) (Middle Region)

Details for Product anti-IL22RA1 Antibody No. ABIN635102
Antigen
Epitop
Middle Region
16
11
6
5
4
3
3
2
2
2
1
1
1
1
1
1
1
Reaktivität
Human
85
30
27
4
4
3
3
2
2
2
2
1
Wirt
Kaninchen
76
7
2
2
Klonalität
Polyklonal
Konjugat
Dieser IL22 Receptor alpha 1 Antikörper ist unkonjugiert
5
4
4
2
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Applikation
Western Blotting (WB)
58
34
13
11
7
6
4
4
3
1
Optionen
Immunogen IL22 R alpha 1 antibody was raised using the middle region of IL22 A1 corresponding to a region with amino acids DQGPSPWGLLESLVCPKDEAKSPAPETSDLEQPTELDSLFRGLALTVQWE
Spezifität IL22 R alpha 1 antibody was raised against the middle region of IL22 A1
Reinigung Affinity purified
Antigen
Andere Bezeichnung IL22R alpha 1 (IL22RA1 Antibody Abstract)
Hintergrund IL22RA1 belongs to the class II cytokine receptor family, and has been shown to be a receptor for interleukin 22 (IL22). IL22 receptor is a protein complex that consists of this protein and interleukin 10 receptor, beta (IL10BR/CRFB4), a subunit also shared by the receptor complex for interleukin 10 (IL10). This gene and interleukin 28 receptor, alpha (IL28RA) form a cytokine receptor gene cluster in the chromosomal region 1p36.
Molekulargewicht 63 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

IL22R alpha 1 Blocking Peptide, catalog no. 33R-2131, is also available for use as a blocking control in assays to test for specificity of this IL22R alpha 1 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IL20 A1 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Interleukin 22 Receptor, alpha 1 (IL22RA1) (Middle Region) antibody (ABIN635102) IL22R alpha 1 antibody used at 1 ug/ml to detect target protein.