DLG3 Antikörper
-
- Target Alle DLG3 Antikörper anzeigen
- DLG3 (Discs, Large Homolog 3 (DLG3))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DLG3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids FPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQDNKFIEAGQF
- Top Product
- Discover our top product DLG3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DLG3 Blocking Peptide, catalog no. 33R-3018, is also available for use as a blocking control in assays to test for specificity of this DLG3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLG3 (Discs, Large Homolog 3 (DLG3))
- Andere Bezeichnung
- DLG3 (DLG3 Produkte)
- Synonyme
- MRX antikoerper, MRX90 antikoerper, NEDLG antikoerper, SAP102 antikoerper, XLMR antikoerper, DLG3 antikoerper, fa66c08 antikoerper, fa66e02 antikoerper, fd02c12 antikoerper, fu95c12 antikoerper, im:7138640 antikoerper, si:ch211-276g21.1 antikoerper, wu:fa66c08 antikoerper, wu:fa66e02 antikoerper, wu:fd02c12 antikoerper, wu:fu95c12 antikoerper, Dlgh3 antikoerper, mKIAA1232 antikoerper, MPP3 antikoerper, 6430514B01 antikoerper, CSG18 antikoerper, Dlg3 antikoerper, Dusp3 antikoerper, discs large MAGUK scaffold protein 3 antikoerper, membrane palmitoylated protein 3 antikoerper, discs, large homolog 3 (Drosophila) antikoerper, membrane protein, palmitoylated 3 (MAGUK p55 subfamily member 3) antikoerper, DLG3 antikoerper, MPP3 antikoerper, dlg3 antikoerper, Dlg3 antikoerper, Mpp3 antikoerper
- Hintergrund
- DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).
- Molekulargewicht
- 90 kDa (MW of target protein)
-