MFRP Antikörper (Membrane Frizzled-Related Protein) (N-Term)

Details for Product anti-MFRP Antibody No. ABIN635098
Antigen
Epitop
N-Term
3
2
2
2
1
1
1
1
Reaktivität
Human
16
4
4
2
2
2
2
2
1
Wirt
Kaninchen
8
5
2
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
15
10
3
3
Optionen
Immunogen MFRP antibody was raised using the N terminal of MFRP corresponding to a region with amino acids TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE
Spezifität MFRP antibody was raised against the N terminal of MFRP
Reinigung Affinity purified
Antigen
Andere Bezeichnung MFRP (MFRP Antibody Abstract)
Hintergrund MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen.
Molekulargewicht 62 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

MFRP Blocking Peptide, catalog no. 33R-8996, is also available for use as a blocking control in assays to test for specificity of this MFRP antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFRP antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Membrane Frizzled-Related Protein (MFRP) (N-Term) antibody (ABIN635098) MFRP antibody used at 1 ug/ml to detect target protein.