MFRP Antikörper (N-Term)

Produktnummer ABIN635098

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch MFRP in WB. Er zeigt eine Reaktivität gegenüber Human.

Kurzübersicht für MFRP Antikörper (N-Term) (ABIN635098)

Target: MFRP (Membrane Frizzled-Related Protein (MFRP))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MFRP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-MFRP Antikörper

Bindungsspezifität: N-Term

Spezifität: MFRP antibody was raised against the N terminal of MFRP

Aufreinigung: Affinity purified

Immunogen: MFRP antibody was raised using the N terminal of MFRP corresponding to a region with amino acids TCGGLLSGPRGFFSSPNYPDPYPPNTHCVWHIQVATDHAIQLKIEALSIE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MFRP Blocking Peptide, (ABIN5614740), is also available for use as a blocking control in assays to test for specificity of this MFRP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFRP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MFRP

Target: MFRP (Membrane Frizzled-Related Protein (MFRP))

Andere Bezeichnung: MFRP

Hintergrund: MFRP is a member of the frizzled-related proteins. It may play a role in eye development, as mutations in this gene have been associated with nanophthalmos, posterior microphthalmia, retinitis pigmentosa, foveoschisis, and optic disc drusen.

Molekulargewicht: 62 kDa (MW of target protein)