COX18 Antikörper

Produktnummer ABIN635096

Produktdetails anti-COX18 Antikörper

Target: COX18 (Cytochrome C Oxidase Assembly Homolog 18 (COX18))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser COX18 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: COX18 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

COX18 Blocking Peptide, catalog no. 33R-4833, is also available for use as a blocking control in assays to test for specificity of this COX18 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX18 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu COX18

Target: COX18 (Cytochrome C Oxidase Assembly Homolog 18 (COX18))

Andere Bezeichnung: COX18 (COX18 Produkte)

Synonyme: COX18HS antikoerper, BC038311 antikoerper, RGD1559547 antikoerper, COX18 cytochrome c oxidase assembly factor L homeolog antikoerper, COX18, cytochrome c oxidase assembly factor antikoerper, cytochrome c oxidase assembly protein 18 antikoerper, cox18.L antikoerper, COX18 antikoerper, Cox18 antikoerper

Hintergrund: COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.

Molekulargewicht: 37 kDa (MW of target protein)