COX18 Antikörper
-
- Target Alle COX18 Antikörper anzeigen
- COX18 (Cytochrome C Oxidase Assembly Homolog 18 (COX18))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser COX18 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- COX18 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR
- Top Product
- Discover our top product COX18 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
COX18 Blocking Peptide, catalog no. 33R-4833, is also available for use as a blocking control in assays to test for specificity of this COX18 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX18 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COX18 (Cytochrome C Oxidase Assembly Homolog 18 (COX18))
- Andere Bezeichnung
- COX18 (COX18 Produkte)
- Hintergrund
- COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.
- Molekulargewicht
- 37 kDa (MW of target protein)
-