Cytochrome C Oxidase Assembly Homolog 18 (Yeast) (COX18) Antikörper

Details zu Produkt Nr. ABIN635096
Antigen
Reaktivität
Human
20
10
7
3
3
2
2
2
2
1
Wirt
Kaninchen
20
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
12
9
4
3
1
1
Optionen
Immunogen COX18 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR
Reinigung Affinity purified
Antigen
Andere Bezeichnung COX18 (COX18 Antibody Abstract)
Hintergrund COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.
Molekulargewicht 37 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

COX18 Blocking Peptide, catalog no. 33R-4833, is also available for use as a blocking control in assays to test for specificity of this COX18 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX18 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Cytochrome C Oxidase Assembly Homolog 18 (Yeast) (COX18) antibody (ABIN635096) COX18 antibody used at 1 ug/ml to detect target protein.