MRS2 Antikörper (Middle Region)

Produktnummer ABIN635094

Produktdetails anti-MRS2 Antikörper

Target: MRS2 (MRS2 Magnesium Homeostasis Factor Homolog (MRS2))

Bindungsspezifität: Middle Region

Reaktivität: Maus, Ratte, Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MRS2 L antibody was raised against the middle region of Mrs2

Aufreinigung: Affinity purified

Immunogen: MRS2 L antibody was raised using the middle region of Mrs2 corresponding to a region with amino acids LDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRS2L Blocking Peptide, catalog no. 33R-4838, is also available for use as a blocking control in assays to test for specificity of this MRS2L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRS0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRS2

Target: MRS2 (MRS2 Magnesium Homeostasis Factor Homolog (MRS2))

Andere Bezeichnung: MRS2L (MRS2 Produkte)

Synonyme: Gm902 antikoerper, HPT antikoerper, Mrs2l antikoerper, RPT antikoerper, Rpt antikoerper, MRS2L antikoerper, MRS2 magnesium transporter antikoerper, MRS2, magnesium transporter antikoerper, Mrs2 antikoerper, MRS2 antikoerper

Hintergrund: MRS2L is a magnesium transporter that may mediate the influx of magnesium into the mitochondrial matrix.

Molekulargewicht: 50 kDa (MW of target protein)