NNT Antikörper (N-Term)

Produktnummer ABIN635092

Produktdetails anti-NNT Antikörper

Target: NNT (Nicotinamide Nucleotide Transhydrogenase (NNT))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NNT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NNT antibody was raised against the N terminal of NNT

Aufreinigung: Affinity purified

Immunogen: NNT antibody was raised using the N terminal of NNT corresponding to a region with amino acids IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NNT Blocking Peptide, catalog no. 33R-4206, is also available for use as a blocking control in assays to test for specificity of this NNT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NNT

Target: NNT (Nicotinamide Nucleotide Transhydrogenase (NNT))

Andere Bezeichnung: NNT (NNT Produkte)

Synonyme: Afu5g02780 antikoerper, GCCD4 antikoerper, 4930423F13Rik antikoerper, AI323702 antikoerper, BB168308 antikoerper, wu:fa20d10 antikoerper, wu:fc86a04 antikoerper, zgc:76979 antikoerper, Nicotinamide Nucleotide Transhydrogenase antikoerper, nicotinamide nucleotide transhydrogenase antikoerper, nicotinamide nucleotide transhydrogenase L homeolog antikoerper, nnt-1 antikoerper, AFUA_5G02780 antikoerper, nnt antikoerper, NNT antikoerper, Nnt antikoerper, nnt.L antikoerper

Hintergrund: NNT is an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification.

Molekulargewicht: 114 kDa (MW of target protein)

Pathways: Proton Transport