NNT Antikörper (Nicotinamide Nucleotide Transhydrogenase) (N-Term)

Details for Product anti-NNT Antibody No. ABIN635092
Antigen
Epitop
N-Term
4
3
2
1
1
1
1
1
Reaktivität
Human, Maus, Ratte (Rattus)
47
37
34
5
4
4
2
2
2
1
1
1
1
Wirt
Kaninchen
44
3
Klonalität
Polyklonal
Konjugat
Dieser NNT Antikörper ist unkonjugiert
2
2
2
2
2
2
2
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
30
13
9
9
5
3
1
1
1
Optionen
Immunogen NNT antibody was raised using the N terminal of NNT corresponding to a region with amino acids IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM
Spezifität NNT antibody was raised against the N terminal of NNT
Reinigung Affinity purified
Antigen
Andere Bezeichnung NNT (NNT Antibody Abstract)
Hintergrund NNT is an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification.
Molekulargewicht 114 kDa (MW of target protein)
Pathways Proton Transport
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

NNT Blocking Peptide, catalog no. 33R-4206, is also available for use as a blocking control in assays to test for specificity of this NNT antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NNT antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Nicotinamide Nucleotide Transhydrogenase (NNT) (N-Term) antibody (ABIN635092) NNT antibody used at 1 ug/ml to detect target protein.