CPT1A Antikörper

Produktnummer ABIN635089

Produktdetails anti-CPT1A Antikörper

Target: CPT1A (Carnitine Palmitoyltransferase 1A (Liver) (CPT1A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPT1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CPT1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CPT1A Blocking Peptide, catalog no. 33R-5461, is also available for use as a blocking control in assays to test for specificity of this CPT1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPT1A

Target: CPT1A (Carnitine Palmitoyltransferase 1A (Liver) (CPT1A))

Andere Bezeichnung: CPT1A (CPT1A Produkte)

Synonyme: MGC53498 antikoerper, CPT1 antikoerper, CPT1-L antikoerper, L-CPT1 antikoerper, L-CPTI antikoerper, si:dkey-56p7.8 antikoerper, C730027G07 antikoerper, CPTI antikoerper, Cpt1 antikoerper, CPT-Ia antikoerper, carnitine palmitoyltransferase 1A (liver) L homeolog antikoerper, carnitine palmitoyltransferase 1A antikoerper, carnitine palmitoyltransferase 1A (liver) antikoerper, carnitine palmitoyltransferase 1Aa (liver) antikoerper, carnitine palmitoyltransferase 1a, liver antikoerper, cpt1a.L antikoerper, CPT1A antikoerper, cpt1a antikoerper, cpt1aa antikoerper, Cpt1a antikoerper

Hintergrund: The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.

Molekulargewicht: 86 kDa (MW of target protein)

Pathways: AMPK Signaling, Regulation of Lipid Metabolism by PPARalpha, Feeding Behaviour, Monocarboxylic Acid Catabolic Process