CPT1A Antikörper

Produktnummer ABIN635089

Produktdetails anti-CPT1A Antikörper

Target: CPT1A (Carnitine Palmitoyltransferase 1A (Liver) (CPT1A))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CPT1A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: CPT1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids LSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLIN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CPT1A Blocking Peptide, catalog no. 33R-5461, is also available for use as a blocking control in assays to test for specificity of this CPT1A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CPT1A

Target: CPT1A (Carnitine Palmitoyltransferase 1A (Liver) (CPT1A))

Andere Bezeichnung: CPT1A (CPT1A Produkte)

Hintergrund: The mitochondrial oxidation of long-chain fatty acids is initiated by the sequential action of carnitine palmitoyltransferase I (which is located in the outer membrane and is detergent-labile) and carnitine palmitoyltransferase II (which is located in the inner membrane and is detergent-stable), together with a carnitine-acylcarnitine translocase. CPT I is the key enzyme in the carnitine-dependent transport across the mitochondrial inner membrane and its deficiency results in a decreased rate of fatty acid beta-oxidation.

Molekulargewicht: 86 kDa (MW of target protein)

Pathways: AMPK Signaling, Regulation of Lipid Metabolism by PPARalpha, Feeding Behaviour, Monocarboxylic Acid Catabolic Process