SLC25A34 Antikörper (Middle Region)

Produktnummer ABIN635088

Dieses Anti-SLC25A34-Antikörper ist ein Kaninchen Polyklonal-Antikörper zur Detektion von SLC25A34 in WB. Geeignet für Human und Maus.

Kurzübersicht für SLC25A34 Antikörper (Middle Region) (ABIN635088)

Target: SLC25A34 (Solute Carrier Family 25, Member 34 (SLC25A34))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A34 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SLC25A34 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SLC25 A34 antibody was raised against the middle region of SLC25 34

Aufreinigung: Affinity purified

Immunogen: SLC25 A34 antibody was raised using the middle region of SLC25 34 corresponding to a region with amino acids TDCMVKIWRQEGPLALYKGLGPAYLRLGPHTILSMLFWDELRKLAGRAQH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A34 Blocking Peptide, (ABIN5616222), is also available for use as a blocking control in assays to test for specificity of this SLC25A34 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 34 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A34

Target: SLC25A34 (Solute Carrier Family 25, Member 34 (SLC25A34))

Andere Bezeichnung: SLC25A34

Hintergrund: SLC25A35 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. It is a multi-pass membrane protein. The functions of SLC25A35 remain unknown.SLC25A35 belongs to the SLC25 family of mitochondrial carrier proteins.

Molekulargewicht: 32 kDa (MW of target protein)