SLC25A46 Antikörper (Solute Carrier Family 25, Member 46) (C-Term)

Details for Product anti-SLC25A46 Antibody No. ABIN635085
Antigen
Epitop
C-Term
4
2
1
1
1
Reaktivität
Human, Maus
16
11
9
4
4
4
3
2
2
1
1
1
1
1
Wirt
Kaninchen
16
Klonalität
Polyklonal
Konjugat
Dieser SLC25A46 Antikörper ist unkonjugiert
1
1
1
Applikation
Western Blotting (WB)
13
10
5
1
Optionen
Immunogen SLC25 A46 antibody was raised using the C terminal of SLC25 46 corresponding to a region with amino acids LKRKTYNSHLAESTSPVQSMLDAYFPELIANFAASLCSDVILYPLETVLH
Spezifität SLC25 A46 antibody was raised against the C terminal of SLC25 46
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC25A46 (SLC25A46 Antibody Abstract)
Hintergrund SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.SLC25A46 belongs to the SLC25 family of mitochondrial carrier proteins.
Molekulargewicht 46 kDa (MW of target protein)
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC25A46 Blocking Peptide, catalog no. 33R-5100, is also available for use as a blocking control in assays to test for specificity of this SLC25A46 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 46 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 25, Member 46 (SLC25A46) (C-Term) antibody (ABIN635085) SLC25A46 antibody used at 1 ug/ml to detect target protein.