SLC25A39 Antikörper (Solute Carrier Family 25, Member 39) (C-Term)

Details for Product anti-SLC25A39 Antibody No. ABIN635082
Antigen
Epitop
C-Term
2
Reaktivität
Human, Maus, Ratte (Rattus), Hund
5
4
3
3
2
2
2
2
2
1
1
Wirt
Kaninchen
5
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
4
3
2
1
Optionen
Immunogen SLC25 A39 antibody was raised using the C terminal of SLC25 39 corresponding to a region with amino acids RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF
Spezifität SLC25 A39 antibody was raised against the C terminal of SLC25 39
Reinigung Affinity purified
Antigen
Andere Bezeichnung SLC25A39 (SLC25A39 Antibody Abstract)
Hintergrund SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.
Molekulargewicht 39 kDa (MW of target protein)
Applikations-hinweise WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

SLC25A39 Blocking Peptide, catalog no. 33R-8252, is also available for use as a blocking control in assays to test for specificity of this SLC25A39 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 39 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Solute Carrier Family 25, Member 39 (SLC25A39) (C-Term) antibody (ABIN635082) SLC25A39 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml t...
Image no. 2 for anti-Solute Carrier Family 25, Member 39 (SLC25A39) (C-Term) antibody (ABIN635082) SLC25A39 antibody used at 0.5 ug/ml to detect target protein.