SLC25A39 Antikörper (C-Term)
Kurzübersicht für SLC25A39 Antikörper (C-Term) (ABIN635082)
Target
Alle SLC25A39 Antikörper anzeigenReaktivität
Wirt
Klonalität
Konjugat
Applikation
-
-
Bindungsspezifität
- C-Term
-
Spezifität
- SLC25 A39 antibody was raised against the C terminal of SLC25 39
-
Aufreinigung
- Affinity purified
-
Immunogen
- SLC25 A39 antibody was raised using the C terminal of SLC25 39 corresponding to a region with amino acids RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF
-
-
-
-
Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. -
Kommentare
-
SLC25A39 Blocking Peptide, (ABIN5616225), is also available for use as a blocking control in assays to test for specificity of this SLC25A39 antibody
-
Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
-
-
Format
- Lyophilized
-
Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 39 antibody in PBS
-
Konzentration
- Lot specific
-
Buffer
- PBS
-
Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. -
Lagerung
- 4 °C/-20 °C
-
Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
-
- SLC25A39 (Solute Carrier Family 25, Member 39 (SLC25A39))
-
Andere Bezeichnung
- SLC25A39
-
Hintergrund
- SLC25A39 is a member of the solute carrier family 25 and is known to transport molecules over the mitochondrial membrane.
-
Molekulargewicht
- 39 kDa (MW of target protein)
Target
-