LINGO4 Antikörper (Middle Region)

Produktnummer ABIN635071

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch LINGO4 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für LINGO4 Antikörper (Middle Region) (ABIN635071)

Target: LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LINGO4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LINGO4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LINGO4 antibody was raised against the middle region of LINGO4

Aufreinigung: Affinity purified

Immunogen: LINGO4 antibody was raised using the middle region of LINGO4 corresponding to a region with amino acids TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LINGO4 Blocking Peptide, (ABIN5614462), is also available for use as a blocking control in assays to test for specificity of this LINGO4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LINGO4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LINGO4

Target: LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))

Andere Bezeichnung: LINGO4

Hintergrund: The function of LINGO4 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 64 kDa (MW of target protein)