LINGO4 Antikörper (Middle Region)

Produktnummer ABIN635071

Dieses Kaninchen Polyklonal-Antikörper erkennt spezifisch LINGO4 in WB. Er zeigt eine Reaktivität gegenüber Human, Maus und Ratte.

Kurzübersicht für LINGO4 Antikörper (Middle Region) (ABIN635071)

Target: LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LINGO4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-LINGO4 Antikörper

Bindungsspezifität: Middle Region

Spezifität: LINGO4 antibody was raised against the middle region of LINGO4

Aufreinigung: Affinity purified

Immunogen: LINGO4 antibody was raised using the middle region of LINGO4 corresponding to a region with amino acids TLEIRSVQLRDRGAYVCVVSNVAGNDSLRTWLEVIQVEPPNGTLSDPNIT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LINGO4 Blocking Peptide, (ABIN5614462), is also available for use as a blocking control in assays to test for specificity of this LINGO4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LINGO4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LINGO4

Target: LINGO4 (Leucine Rich Repeat and Ig Domain Containing 4 (LINGO4))

Andere Bezeichnung: LINGO4

Hintergrund: The function of LINGO4 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 64 kDa (MW of target protein)