PEMT Antikörper (C-Term)

Produktnummer ABIN635064

Der Kaninchen Polyklonal anti-PEMT Antikörper (ABIN635064) detektiert spezifisch PEMT in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für PEMT Antikörper (C-Term) (ABIN635064)

Target: PEMT (Phosphatidylethanolamine N-Methyltransferase (PEMT))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PEMT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PEMT Antikörper

Bindungsspezifität: C-Term

Spezifität: PEMT antibody was raised against the C terminal of PEMT

Aufreinigung: Affinity purified

Immunogen: PEMT antibody was raised using the C terminal of PEMT corresponding to a region with amino acids GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PEMT Blocking Peptide, (ABIN939050), is also available for use as a blocking control in assays to test for specificity of this PEMT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEMT antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PEMT

Target: PEMT (Phosphatidylethanolamine N-Methyltransferase (PEMT))

Andere Bezeichnung: PEMT

Hintergrund: PEMT is an enzyme which converts phosphatidylethanolamine to phosphatidylcholine by sequential methylation in the liver. The protein localizes to the endoplasmic reticulum and mitochondria-associated membranes. The gene encodes PEMT protein is within the Smith-Magenis syndrome region on chromosome 17.

Molekulargewicht: 26 kDa (MW of target protein)