Na+/H+ Exchanger Domain Containing 2 (NHEDC2) (C-Term) Antikörper

Details zu Produkt Nr. ABIN635063
Antigen
Epitop
C-Term
10
10
7
3
1
Reaktivität
Human, Maus, Ratte (Rattus)
40
18
18
2
2
1
1
1
1
1
Wirt
Kaninchen
37
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
28
16
13
3
Optionen
Immunogen NHEDC2 antibody was raised using the C terminal of NHEDC2 corresponding to a region with amino acids IFISFAWLPKATVQAAIGSVALDTARSHGEKQLEDYGMDVLTVAFLSILI
Spezifität NHEDC2 antibody was raised against the C terminal of NHEDC2
Reinigung Affinity purified
Antigen
Andere Bezeichnung NHEDC2 (NHEDC2 Antibody Abstract)
Hintergrund Sodium hydrogen antiporters, such as NHEDC2, convert the proton motive force established by the respiratory chain or the F1F0 mitochondrial ATPase into sodium gradients that drive other energy-requiring processes, transduce environmental signals into cell responses, or function in drug efflux.
Molekulargewicht 57 kDa (MW of target protein)
Pathways Proton Transport
Applikations-hinweise WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Kommentare

NHEDC2 Blocking Peptide, catalog no. 33R-3957, is also available for use as a blocking control in assays to test for specificity of this NHEDC2 antibody

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Lyophilized
Rekonstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NHEDC2 antibody in PBS
Konzentration Lot specific
Buffer PBS
Handhabung Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Lagerung 4 °C
Informationen zur Lagerung Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Bilder des Herstellers
Image no. 1 for anti-Na+/H+ Exchanger Domain Containing 2 (NHEDC2) (C-Term) antibody (ABIN635063) NHEDC2 antibody used at 1 ug/ml to detect target protein.